PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g007230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 321aa    MW: 36766.7 Da    PI: 6.9992
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g007230.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.3e-18119171456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Csa08g007230.1 119 KKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 171
                     4568889*********************************************9 PP

2HD-ZIP_I/II128.33.2e-41117208192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekk+rl+ eqv++LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L +++++L++el 
  Csa08g007230.1 117 EKKKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELV 208
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-19109175IPR009057Homeodomain-like
SMARTSM003892.6E-17116177IPR001356Homeobox domain
PROSITE profilePS5007116.552117173IPR001356Homeobox domain
CDDcd000869.39E-16118174No hitNo description
PfamPF000463.4E-15119171IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-19121181IPR009057Homeodomain-like
PRINTSPR000311.2E-5144153IPR000047Helix-turn-helix motif
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5153169IPR000047Helix-turn-helix motif
PfamPF021834.7E-15173212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MYMYEEGRNN ISNNQEGLRL EMAFPQHGFM FQQLHEDNTH HLPSPTSLPS CPPHLFYGGG  60
GGGNYMMNRS MSFTGVPDHH HNLTQKSPTT TNNMNDQDQV GEEDNLSDDG SHMMLGEKKK  120
RLNLEQVRAL EKSFELGNKL EPERKMQLAK ALGLQPRQIA IWFQNRRARW KTKQLERDYD  180
SLKKQFDVLK SDNDSLLAHN KKLHAELVAL KKHDRKESAK IKRELAEASW SNNGSTENNH  240
NNNTSDINHV SMIKDLFPSS IRSATAAATT TSTHIDHHQM VQEQDQGFCN IFNGIDETTS  300
ASYWAWPDQQ QQHHNHHQFN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165173RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293640.0AK229364.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-61-C06.
GenBankBT0440590.0BT044059.1 Arabidopsis thaliana unknown protein (At5g15150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420169.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like isoform X1
SwissprotQ004660.0HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLR0FGQ40.0R0FGQ4_9BRAS; Uncharacterized protein
STRINGAT5G15150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-164homeobox 3